Rv1106c from Mycobacterium tuberculosis is a 3beta-hydroxysteroid dehydrogenase.
Journal: 2007/October - Biochemistry
ISSN: 0006-2960
Abstract:
New approaches are required to combat Mycobacterium tuberculosis (Mtb), especially the multi-drug resistant and extremely drug resistant organisms (MDR-TB and XDR-TB). There are many reports that mycobacteria oxidize 3beta-hydroxysterols to 3-ketosteroids, but the enzymes responsible for this activity have not been identified in mycobacterial species. In this work, the Rv1106c gene that is annotated as a 3beta-hydroxysteroid dehydrogenase in Mtb has been cloned and heterologously expressed. The purified enzyme was kinetically characterized and found to have a pH optimum between 8.5 and 9.5. The enzyme, which is a member of the short chain dehydrogenase superfamily, uses NAD+ as a cofactor and oxidizes cholesterol, pregnenolone, and dehydroepiandrosterone to their respective 3-keto-4-ene products. The enzyme forms a ternary complex with NAD+ binding before the sterol. The enzyme shows no substrate preference for dehydroepiandrosterone versus pregnenolone with second-order rate constants (kcat/Km) of 3.2 +/- 0.4 and 3.9 +/- 0.9 microM-1 min-1, respectively, at pH 8.5, 150 mM NaCl, 30 mM MgCl2, and saturating NAD+. Trilostane is a competitive inhibitor of dehydroepiandrosterone with a Ki of 197 +/- 8 microM. The expression of the 3beta-hydroxysteroid dehydrogenase in Mtb is intracellular. Disruption of the 3beta-hydroxysteroid dehydrogenase gene in Mtb abrogates mycobacterial cholesterol oxidation activity. These data are consistent with the Rv1106c gene being the one responsible for 3beta-hydroxysterol oxidation in Mtb.
Relations:
Content
Citations
(33)
References
(45)
Pathways
(1)
Drugs
(3)
Chemicals
(7)
Genes
(1)
Organisms
(1)
Processes
(7)
Affiliates
(1)
Similar articles
Articles by the same authors
Discussion board
Biochemistry 46(31): 9058-9067

<em>Rv1106c</em> from <em>Mycobacterium tuberculosis</em> is a 3β-hydroxysteroid dehydrogenase<sup><a href="#FN2" rid="FN2" class=" fn">†</a></sup>

Experimental Procedures

Materials and general methods

Cholesterol, cholest-4-en-3-one, cholest-5-en-3-one, NAD, NADH, 5-pregnen-3β-ol-20-one, and trilostane were purchased from Sigma-Aldrich (St. Louis, MO). TritonX-100 and progesterone were from Aldrich Fine Chemical Co. (Milwaukee, WI). NADP was from Research Products International Co. (Mount Prospect, IL). Restriction endonucleases and T4 DNA ligase were from New England Biolabs (Beverly, MA). Oligonucleotides were from IDT Inc. (Coralville, IA). Total genomic DNA of M. tuberculosis H37Rv was obtained from the TB Research Materials Facility at Colorado State University (Fort Collins, CO) (NIAD NO1-AI40091). MALDI mass spectra were acquired on a Bruker Autoflex II TOF/TOF. Cloned Pfu DNA polymerase was from Stratagene (La Jolla, CA). Big Dye DNA sequencing (Applied Biosystems, Foster City, CA; performed by the Stony Brook University Sequencing Facility) was used to verify the coding sequence of the expression plasmids. DEAE-52 cellulose was from Whatman (Maidstone, UK). Sephacryl S-200 High resolution was from GE Healthcare Biosciences Corp. (Piscataway, NJ). All other chemicals and solvents of reagent grade were supplied by Fisher Scientific (Pittsburgh, PA). 2xYT is composed of 16 g tryptone, 10 g yeast extract and 5 g NaCl per liter. Buffers used were, A: 50 mM triethanolamine hydrochloride, pH 8.5; B: buffer A + 0.2 mM NaCl; C: 100 mM triethanolamine hydrochloride buffer, pH 8.5; D: buffer C + 0.05% (w/v) triton X-100; E: 100 mM TAPS hydrochloride buffer, 150 mM NaCl, 30 mM MgCl2, pH 8.5; F: buffer E + 0.05% triton X-100.

Expression plasmid construction

The Rv1106c gene was amplified from M. tuberculosis H37Rv total genomic DNA by PCR using the primers 5′-gagGGATCCatgcttcgccgcatgggtg-3′ and 5′-gtgCAATTCa gtggtggtggtggtggtgggcttgactgtggcggccg -3′. The BamHI and EcoRI sites are denoted by capital letters, the C-terminal six-histidine tag added by PCR is in boldface. The PCR product was digested with BamHI and EcoRI and ligated into a similarly digested pFPCAP1 vector (26) to create M. smegmatis expression vector pFPCAP-1106c. The Rv1106c gene was then subcloned by PCR using primers 5′-gagCATATGcttcgcgcatgggtg-3′ and 5′-ggtgAAGCTTctacggcttgactgtggcggccg-3′. The NdeI and HindIII sites are denoted by capital letters, the C-terminal six-histidine tag was removed during the a PCR amplification and a stop codon inserted directly after the last native codon of the Rv1106c gene. The amplified fragment was digested with NdeI and HindIII and ligated into similarly digested pET28b that contained an N-terminal His6-tag of the plasmid to create plasmid pET28b-1106c or ligated into similarly digested pET29a that did not contain an N-terminal His6-tag. DNA sequencing of the plasmids confirmed that the full Rv1106c sequence was inserted correctly and that no mutations were introduced during the cloning procedures.

Expression and purification of the Rv1106c gene product in E. coli

BL21(DE3)pLysS transformed with pET28b-1106c or pET29a-1106c was cultured overnight in LB/kanamycin medium. Starter cultures were used to inoculate 2xYT medium (30 μg/mL kanamycin) at a ratio of 1:100 for around 3 h until OD600=0.6~0.8. Isopropyl β-D-thiogalactoside (IPTG) was added at a final concentration of 0.4 mM to induce protein expression. Cultures were grown at 25 °C for an additional 8 h or at 18 °C for an additional 20 h. The cells were collected by centrifugation at 5,000 g for 30 min. The cell pellet (5 g) was suspended in 30 mL of buffer A and lysed by French press at 10,000 psi. All subsequent steps were conducted at 4°C. Cell debris was removed by centrifugation at 135,000 g for 3 h. The supernatant was precipitated with ammonium sulfate and the 5–10 % (w/v) fraction was collected. This pellet was suspended in buffer A (5 mL) and dialyzed (NMWCO 6,000 – 8,000) against buffer A. The dialysate was loaded onto a column of DEAE-cellulose (30 mm × 25 cm, DE 52) equilibrated with buffer A. Fractions were collected by gradient elution (0.1 to 0.4 M NaCl) and 10 mL fractions were collected. Fractions with activity were combined, concentrated and desalted by ultrafiltration (NMWCO 10,000) to a final volume of 5 mL. This active fraction was then applied to Q-Sepharose (10 mL bed volume) equilibrated in buffer B, and the flow-through was collected and concentrated to a final volume of 2 mL. The concentrate was loaded on a Sephacryl S-200 high-resolution column (20 mm × 120 cm) and eluted with buffer B. Pure fractions containing dehydrogenase activity were collected and concentrated.

The identity of the purified protein was confirmed by tryptic digestion and MALDI mass fingerprinting. Dehydrogenase (~5 μg in gel) was digested with trypsin (400 ng) in 20 μL 50 mMN4HCO3 for 17 h. The tryptic fragments were extracted with 60% CH3CN/H2O, 0.1% TFA (50 μL) three times. The combined extracts were dried and redissolved in 5 μL 0.1% TFA/H2O. MALDI-TOF mass spectra were acquired in positive ion mode using a saturated solution of α-cyano-4-hydroxy cinnamic acid as the matrix.

Activity assays

Initially, the 3β-hydroxysteroid dehydrogenase was assayed at 30 °C for less than 10% of reaction with monitoring of NADH absorbance at 340 nm in buffer C (pregnenolone, DHEA, quercetin or dihydroquercetin as substrate) or buffer D (cholesterol as substrate). Dehydroepiandrosterone, pregnenolone, quercetin or dihydroquercetin stock solutions were prepared in ethanol (3 mM), and cholesterol stocks were prepared in propan-2-ol. The final volume of alcohol was kept constant in all assays and was 5%. Reactions were initiated by the addition of dehydrogenase. Later activity measurements were made as described below for enzyme kinetics.

Product analysis by TLC and HPLC spectroscopy

Enzyme assay solutions (1 mL) at various extents of reaction were extracted with an equal volume of ethyl acetate five times. The ethyl acetate extracts were combined and dried under a stream of N2. Then the dried residue was dissolved in 50 μL ethyl acetate and applied to silica gel thin layer chromatography plates and separated using hexane:ethyl acetate, 4:1 or dichloromethane:ethyl acetate, 5:1. To improve resolution, the plate was developed three times drying the plate in between each run. Steroid products were visualized by UV and staining with phosphomolybdic acid in ethanolic solution (10% w/v). Authentic standards were run on the same plate and co-spotted with the reaction mixtures.

Samples for HPLC analyses (27) were analyzed on a Shimadzu Corp. system (Columbia, MD) comprised of a SCL-10A VP system controller, two LC-10AD solvent pumps, and a Model SPA-20A Prominence UV/VIS. The following conditions were used: stationary phase, Microsorb-MV® C-18 column (Rainin Instrument Corp., Woburn, MA, 5 μm, 100 Å, 4.6 × 250 mm); mobile phase, solvent A, CH3CN/H2O (90:10, v:v) and solvent B, CH3CN/propan-2-ol (85:15, v:v). Samples were eluted for 25 min isocratically with solvent A, followed by a 10-min linear gradient to 100% solvent B, followed by a 45-min isocratic elution with solvent B; the flow rate was 1.25 mL/min; peaks were detected at 212 and 240 nm. Sample aliquots (200 μL) were injected directly from enzyme assay solutions incubated at 30°C that contained 120 μM cholesterol, 5% iso-propanol, 1.4 mM NAD and 0.41 pM dehydrogenase in buffer D. Calibration curves for cholesterol and cholest-5-en-3-one were prepared by the integration of peak area detected at 212 nm for standard solutions ranging in concentration from 0 to 1500 μM. Calibration curves for cholest-4-en-3-one were prepared analogously by the integration of peak area detected at 212 and 240 nm.

Enzyme kinetics

The 3β-hydroxysteroid dehydrogenase was assayed at 30 °C for less than 10% of reaction with monitoring of NADH absorbance at 340 nm in buffer E (pregnenolone or DHEA as substrate) or buffer F (cholesterol as substrate). DHEA or pregnenolone stock solutions were prepared in ethanol (3 mM) and cholesterol stocks were prepared in propan-2-ol. No oxidation of ethanol or propanol was detected in control assays. The enzymatic activity was insensitive to alcohol concentrations between 2.5% (v/v) and 5% (v/v) alcohol, and the final volume of alcohol was kept constant in all assays at 5% (v/v). Reactions were initiated by the addition of dehydrogenase. Initial velocities were measured for varying NAD concentrations (350 – 22400 μM) at different fixed concentrations of DHEA or pregnenolone (30 – 300 μM). Initial velocities were measured for varying trilostane concentrations (0 – 1000 μM) at different fixed concentrations of NAD (88 – 5600 μM) with DHEA at a concentration of 120 μM or at different fixed concentrations of DHEA (11 – 240 μM) with NAD at a concentration of 350 μM. All points are the average of triplicate data points.

Initial velocities were globally fit to the following equations using Grafit software (Version 4.0.10). Ternary complex Michaelis-Menten equation

v = Vm[A][B]/{KiaKmb + Kmb[A] + Kma[B] + [A][B]}
(Eq. 1)

Competitive inhibition equation

v = Vm[S]/{Km(1 + [I]/Kic) + [S]}
(Eq. 2)

Uncompetitive inhibition equation

v = Vm[S]/{Km + [S](1 + [I]Kiu)}
(Eq. 3)

Mixed inhibition equation

v = Vm[S]/{Km(1 + [I]/Kic) + [S](1 + [I]/Kiu)}
(Eq. 4)

Substrate NAD inhibition equation

v = Vm[NAD]/(Km + [NAD] + [NAD]/KiuNAD+)
(Eq. 5)

Fixed second substrate Michaelis-Menten equation

v = Vm[S]/(Km + [S])
(Eq. 6)

Rate pH dependence equation

rate = ratem10/{10 + 1}
(Eq. 7)

where Kma and Kmb are the Michaelis constants for A and B at saturating concentrations of B and A, respectively, Km is the apparent Michaelis constant for a varied substrate at a fixed concentration of the second substrate. Kia is the dissociation constant for enzyme and A, Vm is the maximum velocity, S is the varied substrate, Kic and Kiu are the competitive and uncompetitive inhibition constants, respectively, rate is either kcat or kcat/Km and ratem is the maximal value of either kcat or kcat/Km.

The pH dependence of the 3β-hydroxysteroid dehydrogenase-catalyzed reaction was determined in 100 mM TAPS hydrochloride buffer, 150 mM NaCl, 30 mM MgCl2 and 2.8 mM NAD at different fixed concentrations of DHEA (11 – 240 μM) between pH 6.5 and 9.0. Initial velocity data were fit to eq. (6) to determine the apparent kcat and kcat/Km values at each pH. The apparent pKa’s were then determined from these rate constants and eq. (7).

Culture of CDC 1551 and Rv1106c expression analysis

The Mtb strains used in this study were derivatives of Mtb CDC1551. The Mt1137 ORE corresponds to the Rv1106c ORE in Mtb H37Rv. The Mt1137 transposon mutant (28) was obtained through TARGET, part of NIAID contract #HHSN266200400091C for Tuberculosis Vaccine Testing and Research Materials awarded to Colorado State University. The Mtb cells were cultured at 37 °C in Middlebrook 7H9 (liquid) or 7H10 (solid) (Difco) media that were supplemented with 10% albumin-dextrose-sodium chloride complex (ADN) (29), 0.2% glycerol and 0.05% Tween 80. The kanamycin concentration used for the transposon mutant in Mtb was 20 μg/mL. Induction with cholesterol was done by addition of cholesterol (1 mg/mL final concentration) solubilized in Tween-80 (5% w/v final concentration) to cultures at the mid-logarithmic phase. Cultures were incubated for 24 h at 37 °C and harvested by centrifugation. The culture filtrate was collected and sterile filtered for HPLC assay and enzymatic analysis. The cell pellet was washed by resuspension in 1 mL 50 mM sodium phosphate buffer, pH 7 containing 5% v/v propan-2-ol, the cells pelleted again, and the process repeated two more times to remove cholesterol from the medium. The pellet was resuspended in the same buffer and the cells lysed by bead-beating twice for 1 min, with incubation on ice for 2 min between each bead beating. The cell lysate was centrifuged to remove the cell debris and the supernatant was sterilized by filtration and analyzed for enzymatic activity by HPLC assay. Lysates were incubated with 150 μM cholesterol and 3.5 mM NAD in buffer D at 30 °C for 72 h and then directly injected onto a C18 reversed-phase HPLC column for analysis as described above. A unit of cholesterol oxidation activity was defined as 1 μl cholest-4-en-3-one/min·mg protein under these assay conditions.

Other analyses

The primary sequences of proteins related to Rv1106c were obtained from a BLASTP search initiated on the NIH server (http://www.ncbi.nlm.nih.gov/BLAST/). Multiple-sequence alignments and the phylogenetic tree were produced by the Protein Information Resource (30) using CLUSTALW 1.82 (31) and CLC free workbench 3.2 with default parameters. Signal peptide analysis was performed on the Center for Biological Sequence Analysis server (http://www.cbs.dtu.dk/services/) using SignalP 3.0 (32) and Secretome 2.0 (33). Operon prediction was analyzed on The Institute for Genomic Research website (http://www.tigr.org/tigr-scripts/operons/operons.cgi) (34).

Materials and general methods

Cholesterol, cholest-4-en-3-one, cholest-5-en-3-one, NAD, NADH, 5-pregnen-3β-ol-20-one, and trilostane were purchased from Sigma-Aldrich (St. Louis, MO). TritonX-100 and progesterone were from Aldrich Fine Chemical Co. (Milwaukee, WI). NADP was from Research Products International Co. (Mount Prospect, IL). Restriction endonucleases and T4 DNA ligase were from New England Biolabs (Beverly, MA). Oligonucleotides were from IDT Inc. (Coralville, IA). Total genomic DNA of M. tuberculosis H37Rv was obtained from the TB Research Materials Facility at Colorado State University (Fort Collins, CO) (NIAD NO1-AI40091). MALDI mass spectra were acquired on a Bruker Autoflex II TOF/TOF. Cloned Pfu DNA polymerase was from Stratagene (La Jolla, CA). Big Dye DNA sequencing (Applied Biosystems, Foster City, CA; performed by the Stony Brook University Sequencing Facility) was used to verify the coding sequence of the expression plasmids. DEAE-52 cellulose was from Whatman (Maidstone, UK). Sephacryl S-200 High resolution was from GE Healthcare Biosciences Corp. (Piscataway, NJ). All other chemicals and solvents of reagent grade were supplied by Fisher Scientific (Pittsburgh, PA). 2xYT is composed of 16 g tryptone, 10 g yeast extract and 5 g NaCl per liter. Buffers used were, A: 50 mM triethanolamine hydrochloride, pH 8.5; B: buffer A + 0.2 mM NaCl; C: 100 mM triethanolamine hydrochloride buffer, pH 8.5; D: buffer C + 0.05% (w/v) triton X-100; E: 100 mM TAPS hydrochloride buffer, 150 mM NaCl, 30 mM MgCl2, pH 8.5; F: buffer E + 0.05% triton X-100.

Expression plasmid construction

The Rv1106c gene was amplified from M. tuberculosis H37Rv total genomic DNA by PCR using the primers 5′-gagGGATCCatgcttcgccgcatgggtg-3′ and 5′-gtgCAATTCa gtggtggtggtggtggtgggcttgactgtggcggccg -3′. The BamHI and EcoRI sites are denoted by capital letters, the C-terminal six-histidine tag added by PCR is in boldface. The PCR product was digested with BamHI and EcoRI and ligated into a similarly digested pFPCAP1 vector (26) to create M. smegmatis expression vector pFPCAP-1106c. The Rv1106c gene was then subcloned by PCR using primers 5′-gagCATATGcttcgcgcatgggtg-3′ and 5′-ggtgAAGCTTctacggcttgactgtggcggccg-3′. The NdeI and HindIII sites are denoted by capital letters, the C-terminal six-histidine tag was removed during the a PCR amplification and a stop codon inserted directly after the last native codon of the Rv1106c gene. The amplified fragment was digested with NdeI and HindIII and ligated into similarly digested pET28b that contained an N-terminal His6-tag of the plasmid to create plasmid pET28b-1106c or ligated into similarly digested pET29a that did not contain an N-terminal His6-tag. DNA sequencing of the plasmids confirmed that the full Rv1106c sequence was inserted correctly and that no mutations were introduced during the cloning procedures.

Expression and purification of the Rv1106c gene product in E. coli

BL21(DE3)pLysS transformed with pET28b-1106c or pET29a-1106c was cultured overnight in LB/kanamycin medium. Starter cultures were used to inoculate 2xYT medium (30 μg/mL kanamycin) at a ratio of 1:100 for around 3 h until OD600=0.6~0.8. Isopropyl β-D-thiogalactoside (IPTG) was added at a final concentration of 0.4 mM to induce protein expression. Cultures were grown at 25 °C for an additional 8 h or at 18 °C for an additional 20 h. The cells were collected by centrifugation at 5,000 g for 30 min. The cell pellet (5 g) was suspended in 30 mL of buffer A and lysed by French press at 10,000 psi. All subsequent steps were conducted at 4°C. Cell debris was removed by centrifugation at 135,000 g for 3 h. The supernatant was precipitated with ammonium sulfate and the 5–10 % (w/v) fraction was collected. This pellet was suspended in buffer A (5 mL) and dialyzed (NMWCO 6,000 – 8,000) against buffer A. The dialysate was loaded onto a column of DEAE-cellulose (30 mm × 25 cm, DE 52) equilibrated with buffer A. Fractions were collected by gradient elution (0.1 to 0.4 M NaCl) and 10 mL fractions were collected. Fractions with activity were combined, concentrated and desalted by ultrafiltration (NMWCO 10,000) to a final volume of 5 mL. This active fraction was then applied to Q-Sepharose (10 mL bed volume) equilibrated in buffer B, and the flow-through was collected and concentrated to a final volume of 2 mL. The concentrate was loaded on a Sephacryl S-200 high-resolution column (20 mm × 120 cm) and eluted with buffer B. Pure fractions containing dehydrogenase activity were collected and concentrated.

The identity of the purified protein was confirmed by tryptic digestion and MALDI mass fingerprinting. Dehydrogenase (~5 μg in gel) was digested with trypsin (400 ng) in 20 μL 50 mMN4HCO3 for 17 h. The tryptic fragments were extracted with 60% CH3CN/H2O, 0.1% TFA (50 μL) three times. The combined extracts were dried and redissolved in 5 μL 0.1% TFA/H2O. MALDI-TOF mass spectra were acquired in positive ion mode using a saturated solution of α-cyano-4-hydroxy cinnamic acid as the matrix.

Activity assays

Initially, the 3β-hydroxysteroid dehydrogenase was assayed at 30 °C for less than 10% of reaction with monitoring of NADH absorbance at 340 nm in buffer C (pregnenolone, DHEA, quercetin or dihydroquercetin as substrate) or buffer D (cholesterol as substrate). Dehydroepiandrosterone, pregnenolone, quercetin or dihydroquercetin stock solutions were prepared in ethanol (3 mM), and cholesterol stocks were prepared in propan-2-ol. The final volume of alcohol was kept constant in all assays and was 5%. Reactions were initiated by the addition of dehydrogenase. Later activity measurements were made as described below for enzyme kinetics.

Product analysis by TLC and HPLC spectroscopy

Enzyme assay solutions (1 mL) at various extents of reaction were extracted with an equal volume of ethyl acetate five times. The ethyl acetate extracts were combined and dried under a stream of N2. Then the dried residue was dissolved in 50 μL ethyl acetate and applied to silica gel thin layer chromatography plates and separated using hexane:ethyl acetate, 4:1 or dichloromethane:ethyl acetate, 5:1. To improve resolution, the plate was developed three times drying the plate in between each run. Steroid products were visualized by UV and staining with phosphomolybdic acid in ethanolic solution (10% w/v). Authentic standards were run on the same plate and co-spotted with the reaction mixtures.

Samples for HPLC analyses (27) were analyzed on a Shimadzu Corp. system (Columbia, MD) comprised of a SCL-10A VP system controller, two LC-10AD solvent pumps, and a Model SPA-20A Prominence UV/VIS. The following conditions were used: stationary phase, Microsorb-MV® C-18 column (Rainin Instrument Corp., Woburn, MA, 5 μm, 100 Å, 4.6 × 250 mm); mobile phase, solvent A, CH3CN/H2O (90:10, v:v) and solvent B, CH3CN/propan-2-ol (85:15, v:v). Samples were eluted for 25 min isocratically with solvent A, followed by a 10-min linear gradient to 100% solvent B, followed by a 45-min isocratic elution with solvent B; the flow rate was 1.25 mL/min; peaks were detected at 212 and 240 nm. Sample aliquots (200 μL) were injected directly from enzyme assay solutions incubated at 30°C that contained 120 μM cholesterol, 5% iso-propanol, 1.4 mM NAD and 0.41 pM dehydrogenase in buffer D. Calibration curves for cholesterol and cholest-5-en-3-one were prepared by the integration of peak area detected at 212 nm for standard solutions ranging in concentration from 0 to 1500 μM. Calibration curves for cholest-4-en-3-one were prepared analogously by the integration of peak area detected at 212 and 240 nm.

Enzyme kinetics

The 3β-hydroxysteroid dehydrogenase was assayed at 30 °C for less than 10% of reaction with monitoring of NADH absorbance at 340 nm in buffer E (pregnenolone or DHEA as substrate) or buffer F (cholesterol as substrate). DHEA or pregnenolone stock solutions were prepared in ethanol (3 mM) and cholesterol stocks were prepared in propan-2-ol. No oxidation of ethanol or propanol was detected in control assays. The enzymatic activity was insensitive to alcohol concentrations between 2.5% (v/v) and 5% (v/v) alcohol, and the final volume of alcohol was kept constant in all assays at 5% (v/v). Reactions were initiated by the addition of dehydrogenase. Initial velocities were measured for varying NAD concentrations (350 – 22400 μM) at different fixed concentrations of DHEA or pregnenolone (30 – 300 μM). Initial velocities were measured for varying trilostane concentrations (0 – 1000 μM) at different fixed concentrations of NAD (88 – 5600 μM) with DHEA at a concentration of 120 μM or at different fixed concentrations of DHEA (11 – 240 μM) with NAD at a concentration of 350 μM. All points are the average of triplicate data points.

Initial velocities were globally fit to the following equations using Grafit software (Version 4.0.10). Ternary complex Michaelis-Menten equation

v = Vm[A][B]/{KiaKmb + Kmb[A] + Kma[B] + [A][B]}
(Eq. 1)

Competitive inhibition equation

v = Vm[S]/{Km(1 + [I]/Kic) + [S]}
(Eq. 2)

Uncompetitive inhibition equation

v = Vm[S]/{Km + [S](1 + [I]Kiu)}
(Eq. 3)

Mixed inhibition equation

v = Vm[S]/{Km(1 + [I]/Kic) + [S](1 + [I]/Kiu)}
(Eq. 4)

Substrate NAD inhibition equation

v = Vm[NAD]/(Km + [NAD] + [NAD]/KiuNAD+)
(Eq. 5)

Fixed second substrate Michaelis-Menten equation

v = Vm[S]/(Km + [S])
(Eq. 6)

Rate pH dependence equation

rate = ratem10/{10 + 1}
(Eq. 7)

where Kma and Kmb are the Michaelis constants for A and B at saturating concentrations of B and A, respectively, Km is the apparent Michaelis constant for a varied substrate at a fixed concentration of the second substrate. Kia is the dissociation constant for enzyme and A, Vm is the maximum velocity, S is the varied substrate, Kic and Kiu are the competitive and uncompetitive inhibition constants, respectively, rate is either kcat or kcat/Km and ratem is the maximal value of either kcat or kcat/Km.

The pH dependence of the 3β-hydroxysteroid dehydrogenase-catalyzed reaction was determined in 100 mM TAPS hydrochloride buffer, 150 mM NaCl, 30 mM MgCl2 and 2.8 mM NAD at different fixed concentrations of DHEA (11 – 240 μM) between pH 6.5 and 9.0. Initial velocity data were fit to eq. (6) to determine the apparent kcat and kcat/Km values at each pH. The apparent pKa’s were then determined from these rate constants and eq. (7).

Culture of CDC 1551 and Rv1106c expression analysis

The Mtb strains used in this study were derivatives of Mtb CDC1551. The Mt1137 ORE corresponds to the Rv1106c ORE in Mtb H37Rv. The Mt1137 transposon mutant (28) was obtained through TARGET, part of NIAID contract #HHSN266200400091C for Tuberculosis Vaccine Testing and Research Materials awarded to Colorado State University. The Mtb cells were cultured at 37 °C in Middlebrook 7H9 (liquid) or 7H10 (solid) (Difco) media that were supplemented with 10% albumin-dextrose-sodium chloride complex (ADN) (29), 0.2% glycerol and 0.05% Tween 80. The kanamycin concentration used for the transposon mutant in Mtb was 20 μg/mL. Induction with cholesterol was done by addition of cholesterol (1 mg/mL final concentration) solubilized in Tween-80 (5% w/v final concentration) to cultures at the mid-logarithmic phase. Cultures were incubated for 24 h at 37 °C and harvested by centrifugation. The culture filtrate was collected and sterile filtered for HPLC assay and enzymatic analysis. The cell pellet was washed by resuspension in 1 mL 50 mM sodium phosphate buffer, pH 7 containing 5% v/v propan-2-ol, the cells pelleted again, and the process repeated two more times to remove cholesterol from the medium. The pellet was resuspended in the same buffer and the cells lysed by bead-beating twice for 1 min, with incubation on ice for 2 min between each bead beating. The cell lysate was centrifuged to remove the cell debris and the supernatant was sterilized by filtration and analyzed for enzymatic activity by HPLC assay. Lysates were incubated with 150 μM cholesterol and 3.5 mM NAD in buffer D at 30 °C for 72 h and then directly injected onto a C18 reversed-phase HPLC column for analysis as described above. A unit of cholesterol oxidation activity was defined as 1 μl cholest-4-en-3-one/min·mg protein under these assay conditions.

Other analyses

The primary sequences of proteins related to Rv1106c were obtained from a BLASTP search initiated on the NIH server (http://www.ncbi.nlm.nih.gov/BLAST/). Multiple-sequence alignments and the phylogenetic tree were produced by the Protein Information Resource (30) using CLUSTALW 1.82 (31) and CLC free workbench 3.2 with default parameters. Signal peptide analysis was performed on the Center for Biological Sequence Analysis server (http://www.cbs.dtu.dk/services/) using SignalP 3.0 (32) and Secretome 2.0 (33). Operon prediction was analyzed on The Institute for Genomic Research website (http://www.tigr.org/tigr-scripts/operons/operons.cgi) (34).

Results and Discussion

Bioinformatics analysis of Rv1106c

Protein family analysis indicated that Rv1106c is most closely related to the Nocardia species cholesterol dehydrogenase (75% identity, UniProtKB ID {"type":"entrez-protein","attrs":{"text":"Q03704","term_id":"75346010","term_text":"Q03704"}}Q03704) and other mycobacterial homologs (Fig 1). It shares 24% amino acid identity with the vaccinia virus 3β-hydroxysteroid dehydrogenase (UniProtKB ID {"type":"entrez-protein","attrs":{"text":"O57245","term_id":"56404442","term_text":"O57245"}}O57245) and 29% identity with the human homolog (UniProtKB ID {"type":"entrez-protein","attrs":{"text":"P14060","term_id":"112767","term_text":"P14060"}}P14060).

In the Mtb H37Rv genome, the Rv1106c gene is located within 10 bases of the xseB (Rv1107c) and xseA (Rv1108c) genes, probable exonuclease VII small and large subunits, and 18 bases of a possible nitrobenzyl esterase (Rv1105c). Similar gene pairs are found only in mycobacterial genomes, e.g., Mycobacterium bovis, Mycobacterium avium paratuberculosis, and Mycobacterium leprae. The Nocardia farcinica 3 β-hydroxy steroid dehydrogenase homolog nfa34580 is not paired with the exonuclease VII subunits. Signal peptide analysis indicated that the probability that the Rv1106c gene product is secreted classically with a signal peptide or nonclassically is less than 0.5 and 5%, respectively.

The Rv1106c gene product appears to be a member of the short-chain alcohol dehydrogenase superfamily (35). The glycine-rich sequence Gly-X-X-Gly-X-X-Gly, synonymous to the Rossman fold sequence Gly-X-Gly-X-X-Gly for AMP binding is present as Gly-Gly-Gly-Ala-Gly-Phe-Val-Gly. The same Gly-X-X-Gly-X-X-Gly variation of the motif is present in mammalian 3 β-hydroxy steroid dehydrogenases (36). Moreover, the short-chain alcohol dehydrogenase active site motif Tyr-X-X-X-Lys appears as Tyr-Thr-Gru-Thr-Lys in the translated Rv1106 gene. Lastly, a single aspartate (Asp in the human type 1 3β-hydroxy steroid dehydrogenase) thought to form hydrogen bonds with the 2′, 3′ hydroxyls of the cofactor ribose dictates dehydrogenase specificity for NAD rather than NADP (37). This aspartate is conserved in the Rv1106c sequence (Asp) suggesting that the Rv1106c gene product will preferentially use NAD as a cofactor.

Recombinant expression studies

Attempts to express the Rv1106c gene in M. smegmatis behind the acetamidase promoter were unsuccessful. Rv1106c was expressed in E. coli BL21(DE3)plysS with an N-terminal His6 tag. The expressed protein was present in both the soluble and the membrane fractions. The soluble expressed protein did not bind to Ni or Co IMAC columns in its native form, suggesting that the N-terminus is not exposed in the folded protein. However, it could be purified by IMAC under denaturing conditions (6M guanidium hydrochloride), thus confirming that the expressed protein contained an N-terminal hist ag. The protein identity was confirmed by MALDI-TOF mass analysis of a tryptic peptide mixture generated by in-gel digestion. Eighteen percent of the sequence was covered (Table 1). Expression levels in E, coli BL21(DE3)plysS were 10-fold lower without the N-terminal fusion. The expressed proteins with and without the N-terminal His6 tag were purified by conventional methods to yield rH63BHSD and r3BHSD, respectively. The apparent MW was determined by SDS-PAGE to be 43 kD, as expected for a protein that is not post-translationally processed. On a native gel, the apparent MW of the recombinant protein was that of a monomer.

Table 1

Tryptic Peptides from rH63BHSD identified by MALDI-TOF mass spectrometry.

ResiduesSequences
1–50MGS SHHHHHHS SGLVPRGSHMLRRMGDASLTTELGRVLVTGGAGFVGANL
51–100VTTLLDRGHWVRSFDRAPSLLPAHPQLEVLQGDITDADVCAAAVDGIDTI
101–150FHTAAIIELMGGASVTDEYRQRSFAVNVGGTENLLHAGQRAGVQRFVYTS
151–200SNSWMGGQNIAGGDETLPYTDRFNDLYTETKVVAERFVLAQNGVDGMLT
201–250CAIRPSGIWG NGDQTMFRKLFESVLKGHVKVLVGRKSARLDNSYVHNLIH
251–300GFILAAAHLVPDGTAPGQAY FINDAEPINMFEFARPVLEACGQRWPKMRI
301–350SGPAVRWVMTGWQRLHFRFGFPAPLLEPLAVERLYLDNYFSIAKARRDLG
351–392YEPLFTTQQA LTECLPYYVSLFEQMKNEARAEKTAATVKPKL

Reactions catalyzed by the recombinant enzyme

rH63BHSD was assayed with three sterols: cholesterol, pregnenolone, and dehydroepiandrosterone, two flavonols: quercetin and dihydroquercetin, and nicotinamide cofactors. The cofactor or the sterols were omitted from the assay mixtures as negative controls. Ketone product was formed only in reaction mixtures containing NAD and 3β-hydroxysterol. NADP did not function as a cofactor with any of the three sterols at concentrations up to 10 mM. The cofactor preference is analogous to that reported for the Nocardia cholesterol dehydrogenase (20) and consistent with the conservation of Asp in the short chain alcohol dehydrogenase family. rH63BHSD did not catalyze oxidation of quercetin with NAD or reduction of dihydroquercetin with NADH. The sterol reaction mixtures were analyzed by TLC and products compared to authentic standards. The enzyme catalyzed the oxidation and isomerization of cholesterol, pregnenolone, and dehydroepiandrosterone into cholest-4-en-3-one, progesterone, and androsterone, respectively (Scheme 1). In addition, the cholesterol reaction course was followed by reversed-phase C-18 chromatography, and the identities of the intermediate and product, cholest-5-en-3-one and cholest-4-en-3-one, confirmed by co-injection with standards. The Rv1106c open-reading frame clearly encodes for a 3β-hydroxy sterol dehydrogenase, not a dihydroflavonol reductase.

An external file that holds a picture, illustration, etc.
Object name is nihms62562f5.jpg

Reaction catalyzed by Mtb 3β-hydroxy steroid dehydrogenase (Rv1106c).

The rH6SBHSD enzyme activity with cholesterol was measured as a function of pH and the rate plateaued at pH 8.5. Next the enzyme activity was measured under four different detergent conditions: 0.05% triton X-100, 2% triton X-100, 1% nonyl glucoside, and 1% sodium cholate. There was no activity in nonyl glucoside, and very little activity in sodium cholate. The highest activity was obtained with 2% triton X-100. However, the enzyme activity was not saturated with cholesterol in any of the detergent systems. The highest cholesterol concentration that could reliably be attained was 1 mM cholesterol in 2% triton X-100. At this cholesterol concentration, the specific activity of the rH63BHSD was 2.90 μmol·minmg in 100 mM triethanolamine hydrochloride, pH 8.5.

Dehydroepiandrosterone and pregnenolone have sufficient aqueous solubility that the use of detergent micelles is not required. Both substrates yielded normal saturation kinetics with the Mtb dehydrogenase. The lack of saturation with cholesterol may be due to cholesterol being a poor substrate for the enzyme. Alternatively, it may be due to a low affinity of the enzyme for the detergent micelle surface. After optimization of pH and cation conditions (vide infra), rH63BHSD had the highest specific activity with dehydroepiandrosterone as the substrate; the activity was 2.5–3 fold higher with dehydroepiandrosterone than with cholesterol in 0.05% triton X-100 or pregnenolone. The same relative activities were obtained when each of the three sterols was assayed in the presence of 0.05% triton X-100 in the optimized buffer conditions of 100 mM TAPS hydrochloride, 150 mM NaCl and 30 mM MgCl2 pH 8.5 and 2.8 mM NAD (vide infra). The specific activities measured were 0.15, 0.36, and 0.28 μM min mg for cholesterol, dehydroepiandrosterone, and pregrnenolone, respectively. Dehydroepiandrosterone was used as the substrate in subsequent studies because its solubility and kinetic behavior made it the most amenable to the detailed analysis performed.

Both the recombinant Rv1106c with (rH63BHSD) and without (r3BHSD) an N-terminal histidine tag were assayed with a fixed concentration of dehydroepiandrosterone (300 μM) and NAD was varied from 1–28 mM in 100 mM triethanolamine hydrochloride, pH 8.5, 30 °C. The apparent Km’s for NAD were 2.4 ± 0.7 mM and 2.2 ± 0.3 mM, respectively, demonstrating that the N-terminal histidine tag did not affect substrate binding. Because the r3BHSD protein was expressed at low levels and could not be purified to homogeneity, its kcat could not be accurately determined. All subsequent experiments were performed with N-terminally his-tagged enzyme rH63BHSD because it was expressed at higher levels and was easier to purify.

The substrate specificities reported for the Nocardia cholesterol dehydrogenase were similar, but not identical to those observed for rH63BHSD (20). The Nocardia enzyme utilizes both cholesterol and pregnenolone, whereas no activity with dehydroepiandrosterone was observed. However, the assay conditions used for the latter sterols were not reported. Therefore, it is unclear if the difference in specificity is due to buffer conditions or true differences between the enzymes. Kishi et al. reported a Km of 2.5 mM for cholesterol in 1.87% Triton X-100 for the Nocardia cholesterol dehydrogenase (20). However, the highest cholesterol concentration used was 2.9 mM, suggesting that as with the Mtb enzyme studied in this work, saturation of the Nocardia enzyme with cholesterol was not possible.

pH dependence

Initial velocity kinetic patterns and apparent kinetic constants Km and kcat with dehydroepiandrosterone as the substrate were measured at a fixed concentration of NAD (2.8 mM) in 100 mM TAPS hydrochloride with 150 mM NaCl and 30 mM MgCl2 at pH 9.5, 9.0, 8.5, 8.0, 7.5, 7.0 and 6.5. No catalytic activity was detected below pH 7.5. The apparent pKa for kcat is 7.9 ± 0.1 and the apparent pKa for kcat/Km is 8.1 ± 0.1. The pH optimum of the enzyme is pH 8.5–9.5 (Figure 2). This pH optimum range is comparable to that reported for the Nocardia cholesterol dehydrogenase (20). Further experiments were conducted at pH 8.5 to optimize activity while minimizing decomposition of the NAD cofactor during the assay.

An external file that holds a picture, illustration, etc.
Object name is nihms62562f2a.jpg
An external file that holds a picture, illustration, etc.
Object name is nihms62562f2b.jpg

pH dependence of the reaction catalyzed by rH63BHSD with DHEA as the varied substrate. Conditions: 2.8 mM NAD, 100 mM TAPS hydrochloride buffer, 150 mM NaCl, 30 mM MgCl2, pH 8.5, 30 °C. A, pH dependence of kcat. B, pH dependence of kca/Km. The curves are fits to eq. (7). The data shown are the average of three independent experiments, and the errors are the standard deviation of measurement.

Cation and ionic strength dependence

rH63BHSD was assayed with 10 mM and 1 mM CaCl2, MgCl2, 1 mM FeCl2, CuCl2, ZnCl2, or AgNO3, CuCl2 or 50 mM EDTA in the presence of 150 μM dehydroepiandrosterone, and 3.5 mM NAD in 100 mM triethanolamine hydrochloride, pH 8.5 (Figure 3A). EDTA, Fe, Zn, Ag and Cu inhibited enzymatic activity. Mg and Ca were the best activators of enzymatic activity. Then, rH63BHSD was assayed as a function of NaCl concentration in the presence of 150 μM dehydroepiandrosterone and 2.8 mM NAD in 100 mM TAPS hydrochloride, pH 8.5 (Figure 3B). The activity increased with increasing NaCl and plateaued at about 300 mM. A concentration of 150 mM NaCl was used in subsequent assays as this represented a physiological ionic strength. Next, rH63BHSD was assayed with 10 mM and 1 mM CaCl2, MgCl2, 1 mM FeCl2, CuCl2, ZnCl2, or AgNO3, CuCl2 or 50 mM EDTA in the presence of 150 μM dehydroepiandrosterone, 150 mM NaCl, and 2.8 mM NAD in 100 mM TAPS hydrochloride, pH 8.5 (Figure 3C). The highest activities were observed with Ca, Mg and K. Different concentrations of Mg were assayed in the presence of 150 mM NaCl and and the activity plateaued between 20 mM and 40 mM (Figure 3C). Subsequent assays were performed with 150 mM NaCl and 30 mM MgCl2.

An external file that holds a picture, illustration, etc.
Object name is nihms62562f3a.jpg
An external file that holds a picture, illustration, etc.
Object name is nihms62562f3b.jpg
An external file that holds a picture, illustration, etc.
Object name is nihms62562f3c.jpg

Cation dependence of rH63BHSD activity. A, Specific activity in the presence of assorted cations or EDTA. Conditions: 150 μM DHEA, 3.5 mM NAD, 100 mM triethanolamine hydrochloride buffer, pH 8.5, 30 °C. B, Specific activity as a function of NaCl concentration. Conditions: 150 μM DHEA, 2.8 mM NAD, 100 mM TAPS hydrochloride buffer, pH 8.5, 150 mM NaCl, 30 °C. C, Specific activity in the presence of 150 mM NaCl and assorted cations or EDTA. Conditions: 150 μM DHEA, 2.8 mM NAD, 100 mM TAPS hydrochloride buffer, pH 8.5, 150 mM NaCl, 30 °C. The data shown are the average of three independent experiments, and the errors are the standard deviation of measurement.

Steady-state kinetic assays

Initial velocity data with rH63BHSD and varied substrate concentrations produced an intersecting line pattern (Figure S1, supplemental information) consistent with a sequential binding mechanism as is expected for an alcohol dehydrogenase reaction. Concentrations of NAD higher than 5.6 mM inhibit the dehydrogenase reaction (Figure 4). The substrate inhibition by NAD could be overcome by increasing the concentration of dehydroepiandrosterone. This competitive inhibition suggests that NAD either binds to the E-NAD complex to form a dead-end E-(NAD)2 complex or that the E-NAD complex is itself a dead-end complex. Which species is formed depends on the order of substrate binding in the enzyme-catalyzed reaction. Further analysis with additional inhibitors is required to determine the reaction order (vide infra).

An external file that holds a picture, illustration, etc.
Object name is nihms62562f4.jpg

Steady state kinetics of rHg6BHSD. A plot of initial velocity against NAD at fixed DHEA was fitted to equation (5). Conditions: 120 μM DHEA, 100 mM TAPS hydrochloride buffer, 150 mM NaCl, 30 mM MgCl2, pH 8.5, 30 °C. The data shown are the average of three independent experiments, and the errors are the standard deviation of measurement.

Because of substrate inhibition, the highest concentration of NAD used for fits of initial velocity data to Equation (1) was 4.2 mM. The ternary complex steady-state kinetic parameters were derived by globally fitting the initial velocity data to Equation (1) for an ordered reaction (Table 2). Inhibitors of the reaction catalyzed by rH63BHSD were required in order to determine the order of substrate binding. A steroid-derived inhibitor and a cofactor-derived inhibitor were sought.

Table 2

Michaelis-Menten Constants for rH63BHSD.

Substrate ASubstrate BKia (μM)aKma (μM)aKmb (μM)akcat(S)aKcat/Kmb (μMmin)
NAD+DHEA347 ± 28270 ± 37221 ± 2211. 6 ±0.733.2 ±0.4
NAD+Pregnenolone213 ± 162172 ± 5223 ±51.48 ±0.093.9 ±0.9
A compulsory order ternary-complex mechanism as described in equation (1) was fit to the initial velocity data to yield Kia, KmB, and KmA. Conditions: 100 mM TAPS, 150 mM NaCl, 30 mM MgCl2 buffer, pH 8.5, 30 °C.

Trilostane {(2α,4α,5α,17β)-4,5-epoxy-17-hydroxy-3-oxoandrostane-2-carbonitrile} is a known competitive inhibitor (versus pregnenolone) of mammalian 3β-hydroxysteroid dehydrogenases (38). It was expected that trilostane would be an inhibitor of the Mtb 3 β-hydroxysteroid dehydrogenase as well because the reactions catalyzed by both enzymes, and thus, the substrates, intermediates, and products, are the same. Indeed, trilostane is a micromolar inhibitor of rH63BHSD (Figure S2). Moreover, the cofactor product of oxidation, NADH, was also found to be an inhibitor of the rH63BHSD-catalyzed reaction. The order of the reaction catalyzed by rH63BHSD was determined by analyzing patterns of inhibition by trilostane and NADH (Table 3, Figures S2 and S3). Competitive inhibition by trilostane with respect to dehydroepiandrosterone and competitive inhibition by NADH with respect to NAD suggested that the reaction has a compulsory order. If the order of binding were random, mixed inhibition would have been observed. Uncompetitive inhibition by trilostane with respect to NAD and mixed inhibition by NADH with respect to DHEA indicate that the NAD binds to the enzyme first followed by DHEA to form a ternary complex. This order of reaction is observed for a large number of NAD(P)-dependent dehydrogenases. This information was used to fit an ordered ternary mechanism to the kinetic data acquired for both dehydroepiandrosterone and pregnenolone as substrates. Although kcat is larger for dehydroepiandrosterone, the enzyme has a larger Km for this substrate compared to pregnenolone. Thus, the second-order or specificity rate constants (kcat/Km) are approximately the same for both steroids. A similar lack of specificity has been observed for the human 3 β-hydroxysteroid dehydrogenases (39). The human enzymes catalyze the dehydrogenase reaction at second-order rates similar to those catalyzed by rH63BHSD.

Table 3

Inhibition of rH63BHSD.

Versus DHEAVersus NAD+

InhibitorPattern typeKic (μM)aKiu (μM)aPattern typeKic (μM)aKiu (μM)a
trilostaneCb197 ± 8cn.a.dUCn.a.d180 ± 11e
NADHmixed245 ± 68116 ± 22C72 ± 3n.a. ,f
A compulsory order ternary-complex mechanism was fit to equations 24 with the initial velocity data and the best fit was used to yield Kic, or Kiu. Conditions: 100 mM TAPS hydrochloride buffer, pH 8.5, 150 mM NaCl, 30 mM MgCl2, 30 °C.
C: competitive inhibition; UC: uncompetitive inhibition; mixed: mixed inhibition.
NAD was fixed at 350 μM.
n.a., not applicable.
DHEA was fixed at 120 μM.
DHEA was fixed at 90 μM.

Furthermore, the competitive substrate inhibition by NAD that is observed must be due to the formation of an E-(NAD)2 dead-end or non-productive complex. The structural explanation for how this complex may be formed awaits three-dimensional structural data that is unavailable at present. The initial velocity data versus NAD at a single fixed dehydroepiandrosterone concentration of 120 μM (shown in Figure 4) were fit to Equation (5), and KiNAD+ was determined to be 46.3 ± 7.7 mM. To confirm this value, the competitive substrate inhibition constant was derived by determining the apparent Km and Vm values from all of the initial velocity versus dehydroepiandrosterone plots using Equation (1) and replotting Km/Vm versus NAD (Figure S4). The Km/Vm data for NAD concentrations above 5.6 mM were fit linearly and KiNAD+ was determined to be 40.5 mM (Figure S4). Both analysis methods yielded the same inhibitory dissociation constant confirming that it is not dependent on dehydroepiandrosterone concentration.

In vivo analysis of Rv1106c expression

The substrate specificity and inhibitor analyses presented in this work suggest that Rv1106c encodes a 3 β-hydroxysteroid dehydrogenase. To determine whether Rv1106c is the gene responsible for 3β-hydroxysterol oxidation in vivo, the expression of Rv1106c in wild-type Mtb (CDC1551) and in a transposon mutant in which the MT1137 gene (corresponding to Rv1106c in the H37Rv strain) had been disrupted was investigated.

Wild-type Mtb and MT1137 mutant CDC1551 were grown in Middlebrook 7H9 medium that was supplemented with 10% albumin-dextrose-sodium chloride complex, 0.2% glycerol and 0.05% Tween 80 to mid-log phase. Then, cholesterol (1 mg/mL) solubilized in Tween-80 was added to the cultures and the bacteria were cultured for an additional 24 h. The cell culture supernatants and soluble fraction of the cell lysate were assayed for their ability to oxidize cholesterol using an HPLC assay in which cholesterol and cholest-4-en-3-one were detected. The HPLC assay used was not specific for dehydrogenase activity (e.g., versus oxidase activities), it reports on all cholesterol oxidizing activities that may be present. Cholesterol oxidation activity (~0.07 units/liter, two independent experiments) was observed in the soluble fraction of the wild-type cell lysate. No cholesterol oxidation activity was observed in the MT1137 mutant cell lysates. Under the conditions of the HPLC assay used, the limit of detection is 0.0008 units/liter. Thus, disruption of the MT1137 gene reduces the cholesterol oxidation activity of Mtb at least 90-fold. In addition, no cholesterol oxidation activity was observed in either the wild-type or mutant culture filtrates.

The implications of this experiment are several-fold. First, upon disruption of a single gene, all detectable cholesterol oxidation activity is abrogated. This result implies that there is a single sterol-oxidizing enzyme, and that this enzyme is the Rv1106c-encoded 3 β-hydroxysteroid dehydrogenase.

Second, cholesterol oxidation activity was observed only in cell lysates; no activity was observed in culture filtrates. This result suggests that Mtb does not secrete the 3β-hydroxysteroid dehydrogenase encoded by Rv1106c. This observation is consistent with a proteomic analysis that identified the Mtb Rv1106c gene product in the cytosol (40, 41). Third, disruption of the enzymatic activity with a single knockout bodes well for the discovery of small molecule inhibitors that can completely inhibit Mtb cholesterol oxidation in vivo. However, the importance of the latter type of discovery efforts will need to be validated by host-infection virulence studies, which are underway.

Summary

Mycobacteria and related actinomycetes have long been reported to oxidize environmental cholesterol (13, 14). However, the actual identity and genotype of the strains isolated and studied has not always been clear (42). With the recent complete sequencing of several bacterial genomes including that of Mtb (10, 43), it is now possible to connect bacterial phenotypes to specific genes. In this work, genome mining was used to identify a potential 3β-hydroxysterol oxidizing enzyme from Mtb, the product of gene Rv1106c.

Elucidation of the kinetic profile for the heterologously expressed Mtb Rv1106c gene product clearly establishes that the enzyme is a 3β-hydroxysteroid dehydrogenase that oxidizes the 3-hydroxyl and isomerizes the α,γ-unsaturated ketone into the conjugated α,β-unsaturated ketone of at least three sterol substrates, cholesterol, dehydroepiandrosterone, and pregnenolone. Under the conditions optimized in this work, the enzyme is equally specific for dehydroepiandrosterone and pregnenolone, and three-fold less specific for cholesterol. Although the maximal catalytic activity is 10-fold lower with pregnenolone as a substrate than with dehydroepiandrosterone, the apparent binding constant (Km) for pregnenolone is 10-fold better (Table 2). Thus, the in vivo substrate concentrations, and in the case of cholesterol membrane composition, will dictate the substrate selection. At present, these concentrations and membrane compositions are unknown.

The intracellular expression of the Mtb Rv1106c gene product is more consistent with the use of 3β-hydroxy sterols for steroid hormone biosynthesis, for example, by mycobacterial conversion of cholesterol into glucocorticoids as seen in the case of vaccinia virus (25) or androgens, rather than a role in energy metabolism. Mtb does not grow on cholesterol as a sole carbon source. Moreover, all characterized examples of actinomycetes that catabolize 3β-hydroxysterols for energy use, e.g., Rhodococcus (44, 45) and Streptomyces (46), secrete the sterol oxidizing enzyme. Lastly, in contrast to the Mtb Rv1106c gene product, 3-hydroxy sterol oxidases known to be involved in primary metabolism are more specific for cholesterol than dehydroepiandrosterone or pregnenolone (4749).

The intracellular expression of the enzyme suggests that 3β-hydroxysterols must be taken into the mycobacterium from its environment, e.g., the host cell macrophage. An alternative possibility is that the enzymatic substrate is synthesized by the mycobacterium. However, no evidence for the mycobacterial biosynthesis of cholesterol has yet been obtained (77, 78). Future experiments will explore the possible physiological and pathological roles of this enzyme in steroid biosynthesis and degradation.

Bioinformatics analysis of Rv1106c

Protein family analysis indicated that Rv1106c is most closely related to the Nocardia species cholesterol dehydrogenase (75% identity, UniProtKB ID {"type":"entrez-protein","attrs":{"text":"Q03704","term_id":"75346010","term_text":"Q03704"}}Q03704) and other mycobacterial homologs (Fig 1). It shares 24% amino acid identity with the vaccinia virus 3β-hydroxysteroid dehydrogenase (UniProtKB ID {"type":"entrez-protein","attrs":{"text":"O57245","term_id":"56404442","term_text":"O57245"}}O57245) and 29% identity with the human homolog (UniProtKB ID {"type":"entrez-protein","attrs":{"text":"P14060","term_id":"112767","term_text":"P14060"}}P14060).

In the Mtb H37Rv genome, the Rv1106c gene is located within 10 bases of the xseB (Rv1107c) and xseA (Rv1108c) genes, probable exonuclease VII small and large subunits, and 18 bases of a possible nitrobenzyl esterase (Rv1105c). Similar gene pairs are found only in mycobacterial genomes, e.g., Mycobacterium bovis, Mycobacterium avium paratuberculosis, and Mycobacterium leprae. The Nocardia farcinica 3 β-hydroxy steroid dehydrogenase homolog nfa34580 is not paired with the exonuclease VII subunits. Signal peptide analysis indicated that the probability that the Rv1106c gene product is secreted classically with a signal peptide or nonclassically is less than 0.5 and 5%, respectively.

The Rv1106c gene product appears to be a member of the short-chain alcohol dehydrogenase superfamily (35). The glycine-rich sequence Gly-X-X-Gly-X-X-Gly, synonymous to the Rossman fold sequence Gly-X-Gly-X-X-Gly for AMP binding is present as Gly-Gly-Gly-Ala-Gly-Phe-Val-Gly. The same Gly-X-X-Gly-X-X-Gly variation of the motif is present in mammalian 3 β-hydroxy steroid dehydrogenases (36). Moreover, the short-chain alcohol dehydrogenase active site motif Tyr-X-X-X-Lys appears as Tyr-Thr-Gru-Thr-Lys in the translated Rv1106 gene. Lastly, a single aspartate (Asp in the human type 1 3β-hydroxy steroid dehydrogenase) thought to form hydrogen bonds with the 2′, 3′ hydroxyls of the cofactor ribose dictates dehydrogenase specificity for NAD rather than NADP (37). This aspartate is conserved in the Rv1106c sequence (Asp) suggesting that the Rv1106c gene product will preferentially use NAD as a cofactor.

Recombinant expression studies

Attempts to express the Rv1106c gene in M. smegmatis behind the acetamidase promoter were unsuccessful. Rv1106c was expressed in E. coli BL21(DE3)plysS with an N-terminal His6 tag. The expressed protein was present in both the soluble and the membrane fractions. The soluble expressed protein did not bind to Ni or Co IMAC columns in its native form, suggesting that the N-terminus is not exposed in the folded protein. However, it could be purified by IMAC under denaturing conditions (6M guanidium hydrochloride), thus confirming that the expressed protein contained an N-terminal hist ag. The protein identity was confirmed by MALDI-TOF mass analysis of a tryptic peptide mixture generated by in-gel digestion. Eighteen percent of the sequence was covered (Table 1). Expression levels in E, coli BL21(DE3)plysS were 10-fold lower without the N-terminal fusion. The expressed proteins with and without the N-terminal His6 tag were purified by conventional methods to yield rH63BHSD and r3BHSD, respectively. The apparent MW was determined by SDS-PAGE to be 43 kD, as expected for a protein that is not post-translationally processed. On a native gel, the apparent MW of the recombinant protein was that of a monomer.

Table 1

Tryptic Peptides from rH63BHSD identified by MALDI-TOF mass spectrometry.

ResiduesSequences
1–50MGS SHHHHHHS SGLVPRGSHMLRRMGDASLTTELGRVLVTGGAGFVGANL
51–100VTTLLDRGHWVRSFDRAPSLLPAHPQLEVLQGDITDADVCAAAVDGIDTI
101–150FHTAAIIELMGGASVTDEYRQRSFAVNVGGTENLLHAGQRAGVQRFVYTS
151–200SNSWMGGQNIAGGDETLPYTDRFNDLYTETKVVAERFVLAQNGVDGMLT
201–250CAIRPSGIWG NGDQTMFRKLFESVLKGHVKVLVGRKSARLDNSYVHNLIH
251–300GFILAAAHLVPDGTAPGQAY FINDAEPINMFEFARPVLEACGQRWPKMRI
301–350SGPAVRWVMTGWQRLHFRFGFPAPLLEPLAVERLYLDNYFSIAKARRDLG
351–392YEPLFTTQQA LTECLPYYVSLFEQMKNEARAEKTAATVKPKL

Reactions catalyzed by the recombinant enzyme

rH63BHSD was assayed with three sterols: cholesterol, pregnenolone, and dehydroepiandrosterone, two flavonols: quercetin and dihydroquercetin, and nicotinamide cofactors. The cofactor or the sterols were omitted from the assay mixtures as negative controls. Ketone product was formed only in reaction mixtures containing NAD and 3β-hydroxysterol. NADP did not function as a cofactor with any of the three sterols at concentrations up to 10 mM. The cofactor preference is analogous to that reported for the Nocardia cholesterol dehydrogenase (20) and consistent with the conservation of Asp in the short chain alcohol dehydrogenase family. rH63BHSD did not catalyze oxidation of quercetin with NAD or reduction of dihydroquercetin with NADH. The sterol reaction mixtures were analyzed by TLC and products compared to authentic standards. The enzyme catalyzed the oxidation and isomerization of cholesterol, pregnenolone, and dehydroepiandrosterone into cholest-4-en-3-one, progesterone, and androsterone, respectively (Scheme 1). In addition, the cholesterol reaction course was followed by reversed-phase C-18 chromatography, and the identities of the intermediate and product, cholest-5-en-3-one and cholest-4-en-3-one, confirmed by co-injection with standards. The Rv1106c open-reading frame clearly encodes for a 3β-hydroxy sterol dehydrogenase, not a dihydroflavonol reductase.

An external file that holds a picture, illustration, etc.
Object name is nihms62562f5.jpg

Reaction catalyzed by Mtb 3β-hydroxy steroid dehydrogenase (Rv1106c).

The rH6SBHSD enzyme activity with cholesterol was measured as a function of pH and the rate plateaued at pH 8.5. Next the enzyme activity was measured under four different detergent conditions: 0.05% triton X-100, 2% triton X-100, 1% nonyl glucoside, and 1% sodium cholate. There was no activity in nonyl glucoside, and very little activity in sodium cholate. The highest activity was obtained with 2% triton X-100. However, the enzyme activity was not saturated with cholesterol in any of the detergent systems. The highest cholesterol concentration that could reliably be attained was 1 mM cholesterol in 2% triton X-100. At this cholesterol concentration, the specific activity of the rH63BHSD was 2.90 μmol·minmg in 100 mM triethanolamine hydrochloride, pH 8.5.

Dehydroepiandrosterone and pregnenolone have sufficient aqueous solubility that the use of detergent micelles is not required. Both substrates yielded normal saturation kinetics with the Mtb dehydrogenase. The lack of saturation with cholesterol may be due to cholesterol being a poor substrate for the enzyme. Alternatively, it may be due to a low affinity of the enzyme for the detergent micelle surface. After optimization of pH and cation conditions (vide infra), rH63BHSD had the highest specific activity with dehydroepiandrosterone as the substrate; the activity was 2.5–3 fold higher with dehydroepiandrosterone than with cholesterol in 0.05% triton X-100 or pregnenolone. The same relative activities were obtained when each of the three sterols was assayed in the presence of 0.05% triton X-100 in the optimized buffer conditions of 100 mM TAPS hydrochloride, 150 mM NaCl and 30 mM MgCl2 pH 8.5 and 2.8 mM NAD (vide infra). The specific activities measured were 0.15, 0.36, and 0.28 μM min mg for cholesterol, dehydroepiandrosterone, and pregrnenolone, respectively. Dehydroepiandrosterone was used as the substrate in subsequent studies because its solubility and kinetic behavior made it the most amenable to the detailed analysis performed.

Both the recombinant Rv1106c with (rH63BHSD) and without (r3BHSD) an N-terminal histidine tag were assayed with a fixed concentration of dehydroepiandrosterone (300 μM) and NAD was varied from 1–28 mM in 100 mM triethanolamine hydrochloride, pH 8.5, 30 °C. The apparent Km’s for NAD were 2.4 ± 0.7 mM and 2.2 ± 0.3 mM, respectively, demonstrating that the N-terminal histidine tag did not affect substrate binding. Because the r3BHSD protein was expressed at low levels and could not be purified to homogeneity, its kcat could not be accurately determined. All subsequent experiments were performed with N-terminally his-tagged enzyme rH63BHSD because it was expressed at higher levels and was easier to purify.

The substrate specificities reported for the Nocardia cholesterol dehydrogenase were similar, but not identical to those observed for rH63BHSD (20). The Nocardia enzyme utilizes both cholesterol and pregnenolone, whereas no activity with dehydroepiandrosterone was observed. However, the assay conditions used for the latter sterols were not reported. Therefore, it is unclear if the difference in specificity is due to buffer conditions or true differences between the enzymes. Kishi et al. reported a Km of 2.5 mM for cholesterol in 1.87% Triton X-100 for the Nocardia cholesterol dehydrogenase (20). However, the highest cholesterol concentration used was 2.9 mM, suggesting that as with the Mtb enzyme studied in this work, saturation of the Nocardia enzyme with cholesterol was not possible.

pH dependence

Initial velocity kinetic patterns and apparent kinetic constants Km and kcat with dehydroepiandrosterone as the substrate were measured at a fixed concentration of NAD (2.8 mM) in 100 mM TAPS hydrochloride with 150 mM NaCl and 30 mM MgCl2 at pH 9.5, 9.0, 8.5, 8.0, 7.5, 7.0 and 6.5. No catalytic activity was detected below pH 7.5. The apparent pKa for kcat is 7.9 ± 0.1 and the apparent pKa for kcat/Km is 8.1 ± 0.1. The pH optimum of the enzyme is pH 8.5–9.5 (Figure 2). This pH optimum range is comparable to that reported for the Nocardia cholesterol dehydrogenase (20). Further experiments were conducted at pH 8.5 to optimize activity while minimizing decomposition of the NAD cofactor during the assay.

An external file that holds a picture, illustration, etc.
Object name is nihms62562f2a.jpg
An external file that holds a picture, illustration, etc.
Object name is nihms62562f2b.jpg

pH dependence of the reaction catalyzed by rH63BHSD with DHEA as the varied substrate. Conditions: 2.8 mM NAD, 100 mM TAPS hydrochloride buffer, 150 mM NaCl, 30 mM MgCl2, pH 8.5, 30 °C. A, pH dependence of kcat. B, pH dependence of kca/Km. The curves are fits to eq. (7). The data shown are the average of three independent experiments, and the errors are the standard deviation of measurement.

Cation and ionic strength dependence

rH63BHSD was assayed with 10 mM and 1 mM CaCl2, MgCl2, 1 mM FeCl2, CuCl2, ZnCl2, or AgNO3, CuCl2 or 50 mM EDTA in the presence of 150 μM dehydroepiandrosterone, and 3.5 mM NAD in 100 mM triethanolamine hydrochloride, pH 8.5 (Figure 3A). EDTA, Fe, Zn, Ag and Cu inhibited enzymatic activity. Mg and Ca were the best activators of enzymatic activity. Then, rH63BHSD was assayed as a function of NaCl concentration in the presence of 150 μM dehydroepiandrosterone and 2.8 mM NAD in 100 mM TAPS hydrochloride, pH 8.5 (Figure 3B). The activity increased with increasing NaCl and plateaued at about 300 mM. A concentration of 150 mM NaCl was used in subsequent assays as this represented a physiological ionic strength. Next, rH63BHSD was assayed with 10 mM and 1 mM CaCl2, MgCl2, 1 mM FeCl2, CuCl2, ZnCl2, or AgNO3, CuCl2 or 50 mM EDTA in the presence of 150 μM dehydroepiandrosterone, 150 mM NaCl, and 2.8 mM NAD in 100 mM TAPS hydrochloride, pH 8.5 (Figure 3C). The highest activities were observed with Ca, Mg and K. Different concentrations of Mg were assayed in the presence of 150 mM NaCl and and the activity plateaued between 20 mM and 40 mM (Figure 3C). Subsequent assays were performed with 150 mM NaCl and 30 mM MgCl2.

An external file that holds a picture, illustration, etc.
Object name is nihms62562f3a.jpg
An external file that holds a picture, illustration, etc.
Object name is nihms62562f3b.jpg
An external file that holds a picture, illustration, etc.
Object name is nihms62562f3c.jpg

Cation dependence of rH63BHSD activity. A, Specific activity in the presence of assorted cations or EDTA. Conditions: 150 μM DHEA, 3.5 mM NAD, 100 mM triethanolamine hydrochloride buffer, pH 8.5, 30 °C. B, Specific activity as a function of NaCl concentration. Conditions: 150 μM DHEA, 2.8 mM NAD, 100 mM TAPS hydrochloride buffer, pH 8.5, 150 mM NaCl, 30 °C. C, Specific activity in the presence of 150 mM NaCl and assorted cations or EDTA. Conditions: 150 μM DHEA, 2.8 mM NAD, 100 mM TAPS hydrochloride buffer, pH 8.5, 150 mM NaCl, 30 °C. The data shown are the average of three independent experiments, and the errors are the standard deviation of measurement.

Steady-state kinetic assays

Initial velocity data with rH63BHSD and varied substrate concentrations produced an intersecting line pattern (Figure S1, supplemental information) consistent with a sequential binding mechanism as is expected for an alcohol dehydrogenase reaction. Concentrations of NAD higher than 5.6 mM inhibit the dehydrogenase reaction (Figure 4). The substrate inhibition by NAD could be overcome by increasing the concentration of dehydroepiandrosterone. This competitive inhibition suggests that NAD either binds to the E-NAD complex to form a dead-end E-(NAD)2 complex or that the E-NAD complex is itself a dead-end complex. Which species is formed depends on the order of substrate binding in the enzyme-catalyzed reaction. Further analysis with additional inhibitors is required to determine the reaction order (vide infra).

An external file that holds a picture, illustration, etc.
Object name is nihms62562f4.jpg

Steady state kinetics of rHg6BHSD. A plot of initial velocity against NAD at fixed DHEA was fitted to equation (5). Conditions: 120 μM DHEA, 100 mM TAPS hydrochloride buffer, 150 mM NaCl, 30 mM MgCl2, pH 8.5, 30 °C. The data shown are the average of three independent experiments, and the errors are the standard deviation of measurement.

Because of substrate inhibition, the highest concentration of NAD used for fits of initial velocity data to Equation (1) was 4.2 mM. The ternary complex steady-state kinetic parameters were derived by globally fitting the initial velocity data to Equation (1) for an ordered reaction (Table 2). Inhibitors of the reaction catalyzed by rH63BHSD were required in order to determine the order of substrate binding. A steroid-derived inhibitor and a cofactor-derived inhibitor were sought.

Table 2

Michaelis-Menten Constants for rH63BHSD.

Substrate ASubstrate BKia (μM)aKma (μM)aKmb (μM)akcat(S)aKcat/Kmb (μMmin)
NAD+DHEA347 ± 28270 ± 37221 ± 2211. 6 ±0.733.2 ±0.4
NAD+Pregnenolone213 ± 162172 ± 5223 ±51.48 ±0.093.9 ±0.9
A compulsory order ternary-complex mechanism as described in equation (1) was fit to the initial velocity data to yield Kia, KmB, and KmA. Conditions: 100 mM TAPS, 150 mM NaCl, 30 mM MgCl2 buffer, pH 8.5, 30 °C.

Trilostane {(2α,4α,5α,17β)-4,5-epoxy-17-hydroxy-3-oxoandrostane-2-carbonitrile} is a known competitive inhibitor (versus pregnenolone) of mammalian 3β-hydroxysteroid dehydrogenases (38). It was expected that trilostane would be an inhibitor of the Mtb 3 β-hydroxysteroid dehydrogenase as well because the reactions catalyzed by both enzymes, and thus, the substrates, intermediates, and products, are the same. Indeed, trilostane is a micromolar inhibitor of rH63BHSD (Figure S2). Moreover, the cofactor product of oxidation, NADH, was also found to be an inhibitor of the rH63BHSD-catalyzed reaction. The order of the reaction catalyzed by rH63BHSD was determined by analyzing patterns of inhibition by trilostane and NADH (Table 3, Figures S2 and S3). Competitive inhibition by trilostane with respect to dehydroepiandrosterone and competitive inhibition by NADH with respect to NAD suggested that the reaction has a compulsory order. If the order of binding were random, mixed inhibition would have been observed. Uncompetitive inhibition by trilostane with respect to NAD and mixed inhibition by NADH with respect to DHEA indicate that the NAD binds to the enzyme first followed by DHEA to form a ternary complex. This order of reaction is observed for a large number of NAD(P)-dependent dehydrogenases. This information was used to fit an ordered ternary mechanism to the kinetic data acquired for both dehydroepiandrosterone and pregnenolone as substrates. Although kcat is larger for dehydroepiandrosterone, the enzyme has a larger Km for this substrate compared to pregnenolone. Thus, the second-order or specificity rate constants (kcat/Km) are approximately the same for both steroids. A similar lack of specificity has been observed for the human 3 β-hydroxysteroid dehydrogenases (39). The human enzymes catalyze the dehydrogenase reaction at second-order rates similar to those catalyzed by rH63BHSD.

Table 3

Inhibition of rH63BHSD.

Versus DHEAVersus NAD+

InhibitorPattern typeKic (μM)aKiu (μM)aPattern typeKic (μM)aKiu (μM)a
trilostaneCb197 ± 8cn.a.dUCn.a.d180 ± 11e
NADHmixed245 ± 68116 ± 22C72 ± 3n.a. ,f
A compulsory order ternary-complex mechanism was fit to equations 24 with the initial velocity data and the best fit was used to yield Kic, or Kiu. Conditions: 100 mM TAPS hydrochloride buffer, pH 8.5, 150 mM NaCl, 30 mM MgCl2, 30 °C.
C: competitive inhibition; UC: uncompetitive inhibition; mixed: mixed inhibition.
NAD was fixed at 350 μM.
n.a., not applicable.
DHEA was fixed at 120 μM.
DHEA was fixed at 90 μM.

Furthermore, the competitive substrate inhibition by NAD that is observed must be due to the formation of an E-(NAD)2 dead-end or non-productive complex. The structural explanation for how this complex may be formed awaits three-dimensional structural data that is unavailable at present. The initial velocity data versus NAD at a single fixed dehydroepiandrosterone concentration of 120 μM (shown in Figure 4) were fit to Equation (5), and KiNAD+ was determined to be 46.3 ± 7.7 mM. To confirm this value, the competitive substrate inhibition constant was derived by determining the apparent Km and Vm values from all of the initial velocity versus dehydroepiandrosterone plots using Equation (1) and replotting Km/Vm versus NAD (Figure S4). The Km/Vm data for NAD concentrations above 5.6 mM were fit linearly and KiNAD+ was determined to be 40.5 mM (Figure S4). Both analysis methods yielded the same inhibitory dissociation constant confirming that it is not dependent on dehydroepiandrosterone concentration.

In vivo analysis of Rv1106c expression

The substrate specificity and inhibitor analyses presented in this work suggest that Rv1106c encodes a 3 β-hydroxysteroid dehydrogenase. To determine whether Rv1106c is the gene responsible for 3β-hydroxysterol oxidation in vivo, the expression of Rv1106c in wild-type Mtb (CDC1551) and in a transposon mutant in which the MT1137 gene (corresponding to Rv1106c in the H37Rv strain) had been disrupted was investigated.

Wild-type Mtb and MT1137 mutant CDC1551 were grown in Middlebrook 7H9 medium that was supplemented with 10% albumin-dextrose-sodium chloride complex, 0.2% glycerol and 0.05% Tween 80 to mid-log phase. Then, cholesterol (1 mg/mL) solubilized in Tween-80 was added to the cultures and the bacteria were cultured for an additional 24 h. The cell culture supernatants and soluble fraction of the cell lysate were assayed for their ability to oxidize cholesterol using an HPLC assay in which cholesterol and cholest-4-en-3-one were detected. The HPLC assay used was not specific for dehydrogenase activity (e.g., versus oxidase activities), it reports on all cholesterol oxidizing activities that may be present. Cholesterol oxidation activity (~0.07 units/liter, two independent experiments) was observed in the soluble fraction of the wild-type cell lysate. No cholesterol oxidation activity was observed in the MT1137 mutant cell lysates. Under the conditions of the HPLC assay used, the limit of detection is 0.0008 units/liter. Thus, disruption of the MT1137 gene reduces the cholesterol oxidation activity of Mtb at least 90-fold. In addition, no cholesterol oxidation activity was observed in either the wild-type or mutant culture filtrates.

The implications of this experiment are several-fold. First, upon disruption of a single gene, all detectable cholesterol oxidation activity is abrogated. This result implies that there is a single sterol-oxidizing enzyme, and that this enzyme is the Rv1106c-encoded 3 β-hydroxysteroid dehydrogenase.

Second, cholesterol oxidation activity was observed only in cell lysates; no activity was observed in culture filtrates. This result suggests that Mtb does not secrete the 3β-hydroxysteroid dehydrogenase encoded by Rv1106c. This observation is consistent with a proteomic analysis that identified the Mtb Rv1106c gene product in the cytosol (40, 41). Third, disruption of the enzymatic activity with a single knockout bodes well for the discovery of small molecule inhibitors that can completely inhibit Mtb cholesterol oxidation in vivo. However, the importance of the latter type of discovery efforts will need to be validated by host-infection virulence studies, which are underway.

Summary

Mycobacteria and related actinomycetes have long been reported to oxidize environmental cholesterol (13, 14). However, the actual identity and genotype of the strains isolated and studied has not always been clear (42). With the recent complete sequencing of several bacterial genomes including that of Mtb (10, 43), it is now possible to connect bacterial phenotypes to specific genes. In this work, genome mining was used to identify a potential 3β-hydroxysterol oxidizing enzyme from Mtb, the product of gene Rv1106c.

Elucidation of the kinetic profile for the heterologously expressed Mtb Rv1106c gene product clearly establishes that the enzyme is a 3β-hydroxysteroid dehydrogenase that oxidizes the 3-hydroxyl and isomerizes the α,γ-unsaturated ketone into the conjugated α,β-unsaturated ketone of at least three sterol substrates, cholesterol, dehydroepiandrosterone, and pregnenolone. Under the conditions optimized in this work, the enzyme is equally specific for dehydroepiandrosterone and pregnenolone, and three-fold less specific for cholesterol. Although the maximal catalytic activity is 10-fold lower with pregnenolone as a substrate than with dehydroepiandrosterone, the apparent binding constant (Km) for pregnenolone is 10-fold better (Table 2). Thus, the in vivo substrate concentrations, and in the case of cholesterol membrane composition, will dictate the substrate selection. At present, these concentrations and membrane compositions are unknown.

The intracellular expression of the Mtb Rv1106c gene product is more consistent with the use of 3β-hydroxy sterols for steroid hormone biosynthesis, for example, by mycobacterial conversion of cholesterol into glucocorticoids as seen in the case of vaccinia virus (25) or androgens, rather than a role in energy metabolism. Mtb does not grow on cholesterol as a sole carbon source. Moreover, all characterized examples of actinomycetes that catabolize 3β-hydroxysterols for energy use, e.g., Rhodococcus (44, 45) and Streptomyces (46), secrete the sterol oxidizing enzyme. Lastly, in contrast to the Mtb Rv1106c gene product, 3-hydroxy sterol oxidases known to be involved in primary metabolism are more specific for cholesterol than dehydroepiandrosterone or pregnenolone (4749).

The intracellular expression of the enzyme suggests that 3β-hydroxysterols must be taken into the mycobacterium from its environment, e.g., the host cell macrophage. An alternative possibility is that the enzymatic substrate is synthesized by the mycobacterium. However, no evidence for the mycobacterial biosynthesis of cholesterol has yet been obtained (77, 78). Future experiments will explore the possible physiological and pathological roles of this enzyme in steroid biosynthesis and degradation.

Supplementary Material

1File012

SUPPORTING INFORMATION AVAILABLE:

Double reciprocal and secondary plots for two-substrate steady state kinetics and inhibition studies. This material is available free of charge via the Internet at http://pubs.acs.org.

1File012

SUPPORTING INFORMATION AVAILABLE:

Double reciprocal and secondary plots for two-substrate steady state kinetics and inhibition studies. This material is available free of charge via the Internet at http://pubs.acs.org.

Click here to view.(106K, pdf)

Acknowledgments

We thank Yelena Altshuller of the Molecular Cloning Facility at Stony Brook University for isolating the original Rv1106c clone by PCR from genomic DNA.

Department of Chemistry, Stony Brook University, Stony Brook, New York 11794-3400
Public Health Research Institute Center, New Jersey Medical School - UMDNJ, 225 Warren Street, Newark, NJ 07103
*corresponding author: Address: Stony Brook University, Stony Brook, New York 11794-3400, Phone: (631) 632-7952, Fax: (631) 632-5731 ude.koorBynotS@nospmaS.elociN

Abstract

New approaches are required to combat M. tuberculosis (Mtb), especially the multi and extremely drug resistant and organisms (MDR-TB and XDR-TB). There are many reports that mycobacteria oxidize 3β-hydroxysterols to 3-ketosteroids, but the enzyme(s) responsible for this activity have not been identified in mycobacterial species. In this work, the Rv1106c gene that is annotated as a 3β-hydroxysteroid dehydrogenase in Mtb has been cloned and heterologously expressed. The purified enzyme was kinetically characterized and found to have a pH optimum between 8.5 and 9.5. The enzyme, which is a member of the short chain dehydrogenase superfamily, uses NAD as a cofactor and oxidizes cholesterol, pregnenolone and dehydroepiandrosterone to their respective 3-keto-4-ene products. The enzyme forms a ternary complex with NAD binding before the sterol. The enzyme shows no substrate preference for dehydroepiandrosterone versus pregnenolone with second-order rate constants (kcat/Km) of 3.2 ± 0.4 μM min and 3.9 ± 0.9 μM min, respectively at pH 8.5, 150 mM NaCl, 30 mM MgCl2, and saturating NAD. Trilostane is a competitive inhibitor of dehydroepiandrosterone with a Ki of 197 ± 8 |μM. The expression of the 3β-hydroxysteroid dehydrogenase in Mtb is intracellular. Disruption of the 3β-hydroxysteroid dehydrogenase gene in Mtb abrogates mycobacterial cholesterol oxidation activity. These data are consistent with Rv1106c being the gene responsible for 3β-hydroxysterol oxidation in Mtb.

Abstract

Tuberculosis is an opportunistic infection caused by Mycobacterium tuberculosis (Mtb1) in individuals with HIV-AIDS that is estimated to infect 30% of the world’s population (1, 2). The World Health Organization estimates that 2 million people die every year from tuberculosis. Drug resistance to front-line Mtb drugs rifampicin and isoniazid has emerged (3, 4) and additional resistance to second line drugs is emerging (5, 6). It is clear that new approaches are required to combat these multi drug-resistant and extreme (or extensively) drug-resistant organisms (79).

The complete genome sequences of microorganisms are a rich source for mining new drug targets. However, oftentimes, biochemical functions have been assigned to genes purely on the basis of their sequence homology to gene products which are themselves poorly characterized. One such gene is Mtb gene Rv1106c. This gene codes for a putative cholesterol (3β-hydroxysterol) dehydrogenase (10) that is also found in the genomes of related mycobacteria (11, 12). Many actinomycetes and pseudomonads can utilize sterols as a sole carbon source, and 3β-hydroxysteroid oxidation is the first step in this catabolic or degradative pathway (1315). However, unlike other actinomycetes, Mtb cannot survive on sterols alone (16); it will grow if supplemented with asparagine, citrate and Tyloxapol (15). Moreover, reports that mycobacteria synthesize cholesterol (17) have not been substantiated (18). Thus, it is intriguing to consider other possible roles for this enzymatic function in the infectious life cycle of mycobacteria.

Rv1106c is annotated as a cholesterol dehydrogenase because it is 74% identical with the Nocardia sp. cholesterol dehydrogenase. Cholesterol dehydrogenase is an NAD or NADP dependent enzyme and catalyzes two sequential reactions: oxidation of cholesterol (3β-hydroxysterol) to cholest-5-en-3-one and isomerization of cholest-5-en-3-one to cholest-4-en-3-one. The expression of Nocardia cholesterol dehydrogenase is reported to be transcriptionally activated by the addition of cholesterol to culture medium (19, 20). The M. marinum (pathogen that causes fish and amphibian tuberculosis) homolog is preferentially expressed in the frog granuloma (21). Thus, it appears that transcription and expression may be cholesterol dependent, and may require the host to provide the sterol activator.

Gene database analysis has revealed a superfamily of proteins that in addition to the bacterial cholesterol dehydrogenase includes mammalian 3β-hydroxysteroid dehydrogenases, plant dihydroflavonol reductases, bacterial UDP-galactose-4-epimerases and viral 3β-hydroxysteroid dehydrogenases (22, 23) (Figure 1). There appears to be an ancient evolutionary relationship between plant flavonol synthesis and mammalian steroid hormone synthesis and in fact, many flavonols are agonists or antagonists of mammalian steroid hormone receptors (24). The viral 3β-hydroxysteroid dehydrogenases are genetically closest to the mammalian 3β-hydroxysteroid dehydrogenases and the vaccinia virus dehydrogenase functions in viral steroid hormone synthesis. A mutant strain of vaccinia virus carrying a knockout deletion of the vaccinia gene coding for 3β-hydroxysteroid dehydrogenase is attenuated in mice (25). Unlike the wild-type virus, the mutant does not induce the formation of corticosterone, a suppressor of the host inflammatory response to infection. The bacterial 3β-hydroxysteroid dehydrogenases are more distantly related to the mammalian dehydrogenases than their viral counterparts (Figure 1), but they may serve a function similar to the viral enzymes, that is, steroid hormone synthesis, or they may be involved in bacterial flavonol synthesis. Both activities could lead to immune suppression. The ability of actinomycetes such as Mtb or Nocardia, to persist in the intracellular milieu requires mechanisms for abrogating the normal host immune response and targeting the glucocorticoid receptors may be one such mechanism.

An external file that holds a picture, illustration, etc.
Object name is nihms62562f1.jpg

Unrooted phylogenetic tree for 3β-hydroxysteroid dehydrogenase encoded by Rv1106c and related proteins. The values are relative evolutionary distance. The tree was generated using a ClustalW 1.82 alignment and CLC Free Workbench 3. Proteins are identified by species, enzyme, and Uniprot ID.

The similarities among the enzymes of this superfamily hint at the potential catalytic properties of Rv1106c from Mtb. However, the physico-chemical characteristics of this putative 3β-hydroxysteroid dehydrogenase from Mtb have not been defined and its real enzymatic function has not yet been confirmed. Before assigning physiological function, we undertook a fundamental characterization of the chemistry catalyzed by this putative 3β-hydroxysteroid dehydrogenase encoded by Rv1106c and the results of those studies are presented here.

Footnotes

Financial support from the National Institutes of Health ({"type":"entrez-nucleotide","attrs":{"text":"AI065251","term_id":"3340658","term_text":"AI065251"}}AI065251 (N.S.S.), {"type":"entrez-nucleotide","attrs":{"text":"AI065997","term_id":"3342628","term_text":"AI065997"}}AI065997 (I.S.), RR021008, (N.S.S.) and NIAID Contract# HHSN266200400091C, (Colorado State University) and the National Science Foundation (CHE0131146 for NMR spectrometers) is gratefully acknowledged.

Mtb: Mycobacterium tuberculosis; MDR-TB: multi-drug resistant Mycobacterium tuberculosis; XDR-TB: extremely-drug resistant Mycobacterium tuberculosis; DHEA: dehydroepiandrosterone; rH63BHSD: recombinant 3β-hydroxysteroid dehydrogenase with an N-terminal six histidine tag; rSBHSD: recombinant 3β-hydroxysteroid dehydrogenase without an N-terminal six histidine tag; IMAC: immobilized-metal ion affinity chromatography: TAPS: N-tris(hydroxymethyl)methyl-3-aminopropanesulfonic acid

Footnotes

References

  • 1. Kochi AThe global tuberculosis situation and the new control strategy of the World Health Organization. Tubercle. 1991;72:1–6.[PubMed][Google Scholar]
  • 2. Raviglione MC, Snider DE, Jr, Kochi A. Global epidemiology of tuberculosis. Morbidity and mortality of a worldwide epidemic. JAMA. 1995;273:220–226.[PubMed]
  • 3. Byarugaba DKAntimicrobial resistance in developing countries and responsible risk factors. Int J Antimicrob Agents. 2004;24:105–110.[PubMed][Google Scholar]
  • 4. Mwinga A, Bernard Fourie PProspects for new tuberculosis treatment in Africa. Trop Med Int Health. 2004;9:827–832.[PubMed][Google Scholar]
  • 5. Raviglione MC, Smith IMXDR tuberculosis-implications for global public health. N Engl J Med. 2007;356:656–659.[PubMed][Google Scholar]
  • 6. XDR-TB--a global threat. Lancet. 2006;368:964.[PubMed]
  • 7. Rattan A, Kalia A, Ahmad NMultidrug-resistant Mycobacterium tuberculosis: molecular perspectives. Emerg Infect Dis. 1998;4:195–209.[Google Scholar]
  • 8. Marris EExtreme TB strain threatens HIV victims worldwide. Nature. 2006;443:131.[PubMed][Google Scholar]
  • 9. Cohen J. Infectious disease. Extensively drug-resistant TB gets foothold in South Africa. Science. 2006;313:1554.[PubMed]
  • 10. Cole ST, Brosch R, Parkhil J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE, 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BGDeciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998;393:537–544.[PubMed][Google Scholar]
  • 11. Eiglmeier K, Simon S, Gamier T, Cole STThe integrated genome map of Mycobacterium leprae. Lepr Rev. 2001;72:462–469.[PubMed][Google Scholar]
  • 12. Garnier T, Eiglmeier K, Camus JC, Medina N, Mansoor H, Pryor M, Duthoy S, Grondin S, Lacroix C, Monsempe C, Simon S, Harris B, Atkin R, Doggett J, Mayes R, Keating L, Wheeler PR, Parkhill J, Barrell BG, Cole ST, Gordon SV, Hewinson RGThe complete genome sequence of Mycobacterium bovis. Proc Natl Acad Sci U S A. 2003;100:7877–7882.[Google Scholar]
  • 13. Tak JOn bacteria decomposing cholesterol. Antonie Leeuwenhoek. 1942;8:32–40.[PubMed][Google Scholar]
  • 14. Turfitt GE. The microbiological degradation of steroids. 2. Oxidation of cholesterol by Proactinomyces. spp. Biochem J. 1944;38:492–496.
  • 15. Van der Geize R, Yam K, Heuser T, Wilbrink MH, Kara H, Anderton MC, Sim E, Dijkhuizen L, Davies JE, Mohn WW, Eltis LDA gene cluster encoding cholesterol catabolism in a soil actinomycete provides insight into Mycobacterium tuberculosis survival in macrophages. Proc Natl Acad Sci U S A. 2007;104:1947–1952.[Google Scholar]
  • 16. Av-Gay Y, Sobouti RCholesterol is accumulated by mycobacterium but its degradation is limited to non-pathogenic fast-growing mycobacteria. Can J Microbiol. 2000;46:826–831.[PubMed][Google Scholar]
  • 17. Lamb DC, Kelly DE, Manning NJ, Kelly SLA sterol biosynthetic pathway in Mycobacterium. Febs Letters. 1998;437:142–144.[PubMed][Google Scholar]
  • 18. Jackson CJ, Lamb DC, Marczylo TH, Parker JE, Manning NL, Kelly DE, Kelly SLConservation and cloning of CYP51: a sterol 14 alpha-demethylase from Mycobacterium smegmatis. Biochem Biophys Res Commun. 2003;301:558–563.[PubMed][Google Scholar]
  • 19. Horinouchi S, Ishizuka H, Beppu T. Cloning, nucleotide sequence, and transcriptional analysis of the NAD(P)-dependent cholesterol dehydrogenase gene from a Nocardia sp. and its hyperexpression in Streptomyces spp. Appl Environ Microbiol. 1991;57:1386–1393.
  • 20. Kishi K, Watazu Y, Katayama Y, Okabe HThe characteristics and applications of recombinant cholesterol dehydrogenase. Biosci Biotechnol Biochem. 2000;64:1352–1358.[PubMed][Google Scholar]
  • 21. Ramakrishnan L, Federspiel NA, Falkow SGranuloma-specific expression of Mycobacterium virulence proteins from the glycine-rich PE-PGRS family. Science. 2000;288:1436–1439.[PubMed][Google Scholar]
  • 22. Baker ME, Blasco RExpansion of the mammalian 3 beta-hydroxysteroid dehydrogenase/plant dihydroflavonol reductase superfamily to include a bacterial cholesterol dehydrogenase, a bacterial UDP-galactose-4-epimerase, and open reading frames in vaccinia virus and fish lymphocystis disease virus. FEBS Lett. 1992;301:89–93.[PubMed][Google Scholar]
  • 23. Baker ME, Luu-The Y, Simard J, Labrie FA common ancestor for mammalian 3 beta-hydroxysteroid dehydrogenase and plant dihydroflavonol reductase. Biochem J. 1990;269:558–559.[Google Scholar]
  • 24. Baker MEEvolution of regulation of steroid-mediated intercellular communication in vertebrates: insights from flavonoids, signals that mediate plant-rhizobia symbiosis. J Steroid Biochem Mol Biol. 1992;41:301–308.[PubMed][Google Scholar]
  • 25. Reading PC, Moore JB, Smith GLSteroid hormone synthesis by vaccinia virus suppresses the inflammatory response to infection. J Exp Med. 2003;197:1269–1278.[Google Scholar]
  • 26. Changsen C, Franzblau SG, Palittapongarnpim PImproved green fluorescent protein reporter gene-based microplate screening for antituberculosis compounds by utilizing an acetamidase promoter. Antimicrob Agents Chemother. 2003;47:3682–3687.[Google Scholar]
  • 27. Sampson NS, Kass IJIsomerization, but not oxidation, is suppressed by a single point mutation, E361Q, in the reaction catalyzed by cholesterol oxidase. Journal of the American Chemical Society. 1997;119:855–862.[PubMed][Google Scholar]
  • 28. Lamichhane G, Zignol M, Blades NJ, Geiman DE, Dougherty A, Grosset J, Broman KW, Bishai WRA postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Proc Natl Acad Sci U S A. 2003;100:7213–7218.[Google Scholar]
  • 29. Jacobs WR, Jr, Kalpana GV, Cirillo JD, Pascopella L, Snapper SB, Udani RA, Jones W, Barletta RG, Bloom BRGenetic systems for mycobacteria. Methods Enzymol. 1991;204:537–555.[PubMed][Google Scholar]
  • 30. Wu CH, Yeh LS, Huang H, Arminski L, Castro-Alvear J, Chen Y, Hu Z, Kourtesis P, Ledley RS, Suzek BE, Vinayaka CR, Zhang J, Barker WCThe Protein Information Resource. Nucleic Acids Res. 2003;31:345–347.[Google Scholar]
  • 31. Chenna R, Sugawara H, Koike T, Lopez R, Gibson TJ, Higgins DG, Thompson JDMultiple sequence alignment with the Clustal series of programs. Nucleic Acids Res. 2003;31:3497–3500.[Google Scholar]
  • 32. Bendtsen JD, Nielsen H, von Heijne G, Brunak SImproved prediction of signal peptides: SignalP 3.0. J Mol Biol. 2004;340:783–795.[PubMed][Google Scholar]
  • 33. Bendtsen JD, Kiemer L, Fausboll A, Brunak SNon-classical protein secretion in bacteria. BMC Microbiol. 2005;5:58.[Google Scholar]
  • 34. Ermolaeva MD, White O, Salzberg SLPrediction of operons in microbial genomes. Nucleic Acids Res. 2001;29:1216–1221.[Google Scholar]
  • 35. Jornvall H, Persson B, Krook M, Atrian S, Gonzalez-Duarte R, Jeffery J, Ghosh DShort-chain dehydrogenases/reductases (SDR) Biochemistry. 1995;34:6003–6013.[PubMed][Google Scholar]
  • 36. Simard J, Ricketts ML, Gingras S, Soucy P, Feltus FA, Melner MHMolecular biology of the 3beta-hydroxysteroid dehydrogenase/delta5-delta4 isomerase gene family. Endocr Rev. 2005;26:525–582.[PubMed][Google Scholar]
  • 37. Thomas JL, Duax WL, Addlagatta A, Brandt S, Fuller RR, Norris WStructure/function relationships responsible for coenzyme specificity and the isomerase activity of human type 1 3 beta-hydroxysteroid dehydrogenase/isomerase. J Biol Chem. 2003;278:35483–35490.[PubMed][Google Scholar]
  • 38. Potts GO, Creange JE, Hardomg HR, Schane HPTrilostane, an orally active inhibitor of steroid biosynthesis. Steroids. 1978;32:257–267.[PubMed][Google Scholar]
  • 39. Thomas JL, Mason JI, Brandt S, Spencer BR, Jr, Norris WStructure/function relationships responsible for the kinetic differences between human type 1 and type 2 3beta-hydroxysteroid dehydrogenase and for the catalysis of the type 1 activity. J Biol Chem. 2002;277:42795–42801.[PubMed][Google Scholar]
  • 40. Rosenkrands I, King A, Weldingh K, Moniatte M, Moertz E, Andersen PTowards the proteome of Mycobacterium tuberculosis. Electrophoresis. 2000;21:3740–3756.[PubMed][Google Scholar]
  • 41. Rosenkrands I, Weldingh K, Jacobsen S, Hansen CV, Florio W, Gianetri I, Andersen PMapping and identification of Mycobacterium tuberculosis proteins by two-dimensional gel electrophoresis, microsequencing and immunodetection. Electrophoresis. 2000;21:935–948.[PubMed][Google Scholar]
  • 42. Stadtman TCCholesterol dehydrogenase from a Mycobacterium. Meth Enzymol. 1955;I:678–681.[PubMed][Google Scholar]
  • 43. Camus JC, Pryor MJ, Medigue C, Cole STRe-annotation of the genome sequence of Mycobacterium tuberculosis H37Rv. Microbiology. 2002;148:2967–2973.[PubMed][Google Scholar]
  • 44. Sojo M, Bru R, LopezMolina D, GarciaCarmona F, Arguelles JC. Cell-linked and extracellular cholesterol oxidase activities from Rhodococcus erythropolis. Isolation and physiological characterization. App Microbiol Biotech. 1997;47:583–589.[PubMed]
  • 45. Elalami A, Kreit J, Filali-Maltouf A, Boudrant J, Germain PCharacterization of a secreted cholesterol oxidase from Rhodococcus sp GKI (CIP 105335) World J Microbiol Biotech. 1999;15:579–585.[PubMed][Google Scholar]
  • 46. Murooka Y, Ishizaki T, Nimi O, Maekawa NCloning and expression of a Streptomyces cholesterol oxidase gene in Streptomyces lividans with plasmid pIJ702. Appl Environ Microbiol. 1986;52:1382–1385.[Google Scholar]
  • 47. MacLachlan J, Wotherspoon AT, Ansell RO, Brooks CJCholesterol oxidase: sources, physical properties and analytical applications. J Steroid Biochem Mol Biol. 2000;72:169–195.[PubMed][Google Scholar]
  • 48. Sampson NS, Kass IJ, Ghoshroy KBAssessment of the role of an Ω loop of cholesterol oxidase: a truncated loop mutant has altered substrate specificity. Biochemistry. 1998;37:5770–5778.[PubMed][Google Scholar]
  • 49. Smith AG, Brooks CJWThe substrate specificity and stereochemistry, reversiblility and inhibition of the 3-oxo steroid Δ–Δ isomerase component of cholesterol oxidase. Biochem J. 1977;167:121–129.[Google Scholar]
Collaboration tool especially designed for Life Science professionals.Drag-and-drop any entity to your messages.